Molecule Information

General Information of the Molecule (ID: Mol00596)

Name	Ras-related protein Rab-27A (RAP27A) ,Homo sapiens
Synonyms	Rab-27; GTP-binding protein Ram; RAB27 Click to Show/Hide
Molecule Type	Protein
Gene Name	RAB27A
Gene ID	5873
Location	chr15:55202966-55319113[-]
Sequence	MSDGDYDYLIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASGPDG ATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMH AYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDL IMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC Click to Show/Hide
Function	Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate homeostasis of late endocytic pathway, including endosomal positioning, maturation and secretion. Plays a role in cytotoxic granule exocytosis in lymphocytes. Required for both granule maturation and granule docking and priming at the immunologic synapse. Click to Show/Hide
Uniprot ID	RB27A_HUMAN
Ensembl ID	ENSG00000069974
HGNC ID	HGNC:9766
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Prostate cancer				[1]
Sensitive Disease	Prostate cancer [ICD-11: 2C82.0]			Disease Info
Sensitive Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell apoptosis		Activation	hsa04210
In Vitro Model	DU-145 cells	Prostate	Homo sapiens (Human)	CVCL_0105
	PC3 cells	Prostate	Homo sapiens (Human)	CVCL_0035
In Vivo Model	SCID nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Immunoblotting analysis
Experiment for Drug Resistance	Flow cytometry assay
Mechanism Description	Lysosome disturbance caused by miR-205-mediated down-regulation of RAB27A and LAMP3 constraints the completion of the autophagic flux by compromising the maturation step and, consequently, interferes with the detoxifying capabilities by which PCa cells may become resistant to CDDP.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Prostate cancer [ICD-11: 2C82]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Prostate
The Specified Disease	Prostate cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.96E-01; Fold-change: 1.57E-01; Z-score: 2.44E-01
Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	miR-205 impairs the autophagic flux and enhances cisplatin cytotoxicity in castration-resistant prostate cancer cells. Biochem Pharmacol. 2014 Feb 15;87(4):579-97. doi: 10.1016/j.bcp.2013.12.009. Epub 2013 Dec 24.