Molecule Information
General Information of the Molecule (ID: Mol00499)
Name |
Microphthalmia-associated transcription factor (MITF)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Class E basic helix-loop-helix protein 32; bHLHe32; BHLHE32
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
MITF
|
||||
Gene ID | |||||
Location |
chr3:69739456-69968336[+]
|
||||
Sequence |
MQSESGIVPDFEVGEEFHEEPKTYYELKSQPLKSSSSAEHPGASKPPISSSSMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQ THLENPTKYHIQQAQRQQVKQYLSTTLANKHANQVLSLPCPNQPGDHVMPPVPGSSAPNS PMAMLTLNSNCEKEGFYKFEEQNRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE ILGLMDPALQMANTLPVSGNLIDLYGNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY IRKLQREQQRAKELENRQKKLEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNR IIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSK LEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHTC Click to Show/Hide
|
||||
Function |
Transcription factor that regulates the expression of genes with essential roles in cell differentiation, proliferation and survival. Binds to M-boxes (5'-TCATGTG-3') and symmetrical DNA sequences (E-boxes) (5'-CACGTG-3') found in the promoters of target genes, such as BCL2 and tyrosinase (TYR). Plays an important role in melanocyte development by regulating the expression of tyrosinase (TYR) and tyrosinase-related protein 1 (TYRP1). Plays a critical role in the differentiation of various cell types, such as neural crest-derived melanocytes, mast cells, osteoclasts and optic cup-derived retinal pigment epithelium.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Dexamethasone
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Multiple myeloma | [1] | |||
Sensitive Disease | Multiple myeloma [ICD-11: 2A83.0] | |||
Sensitive Drug | Dexamethasone | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell proliferation | Inhibition | hsa05200 | ||
PI3K/AKT signaling pathway | Regulation | hsa04151 | ||
In Vitro Model | U266 cells | Bone marrow | Homo sapiens (Human) | CVCL_0566 |
RPMI-8226 cells | Peripheral blood | Homo sapiens (Human) | CVCL_0014 | |
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
MTT assay | |||
Mechanism Description | miR-137 can improve the dexamethasone sensitivity in multiple myeloma cells by reducing the c-MET expression and further decreasing the AkT phosphorylation via targeting MITF. |
Disease- and Tissue-specific Abundances of This Molecule
ICD Disease Classification 02
Multiple myeloma [ICD-11: 2A83]
Differential expression of molecule in resistant diseases | ||
The Studied Tissue | Bone marrow | |
The Specified Disease | Multiple myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 3.25E-01; Fold-change: -2.04E-01; Z-score: -3.83E-01 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances | Click to View the Clearer Original Diagram | |
The Studied Tissue | Peripheral blood | |
The Specified Disease | Multiple myeloma | |
The Expression Level of Disease Section Compare with the Healthy Individual Tissue | p-value: 4.99E-01; Fold-change: 2.33E-03; Z-score: 1.49E-02 | |
Molecule expression in the diseased tissue of patients
Molecule expression in the normal tissue of healthy individuals
|
||
Disease-specific Molecule Abundances | Click to View the Clearer Original Diagram | |
Tissue-specific Molecule Abundances in Healthy Individuals
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.