Molecule Information
General Information of the Molecule (ID: Mol00488)
Name |
Max dimerization protein 4 (MXD4)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Max dimerizer 4; Class C basic helix-loop-helix protein 12; bHLHc12; Max-associated protein 4; Max-interacting transcriptional repressor MAD4; BHLHC12; MAD4
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
MXD4
|
||||
Gene ID | |||||
Location |
chr4:2247432-2262109[-]
|
||||
Sequence |
MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNE
LEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKKLEEQDRRALSIKEQLQ QEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDA DDHYSLQSGTGGDSGFGPHCRRLGRPALS Click to Show/Hide
|
||||
Function |
Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation (By similarity).
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Bortezomib
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Cutaneous T-cell lymphomas | [1] | |||
Resistant Disease | Cutaneous T-cell lymphomas [ICD-11: 2B00.0] | |||
Resistant Drug | Bortezomib | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell migration | Activation | hsa04670 | ||
Cell proliferation | Activation | hsa05200 | ||
In Vitro Model | MyLa2000 cells | Skin | Homo sapiens (Human) | CVCL_8328 |
SeAx cells | Skin | Homo sapiens (Human) | CVCL_5363 | |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
Flow cytometry assay | |||
Mechanism Description | Bortezomib repressed cMyc and simultaneously induced miR-125b-5p that exerted a cytoprotective effect through the downmodulation of MAD4. miR-125b-5p can regulates tumor growth in vivo,and increases cellular resistance to proteasome inhibitors via modulation of MAD4. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.