Molecule Information

General Information of the Molecule (ID: Mol00471)

Name	Lactate dehydrogenase A (LDHA) ,Homo sapiens
Synonyms	LDH-A; Cell proliferation-inducing gene 19 protein; LDH muscle subunit; LDH-M; Renal carcinoma antigen NY-REN-59; PIG19 Click to Show/Hide
Molecule Type	Protein
Gene Name	LDHA
Gene ID	3939
Location	chr11:18394560-18408425[+]
Sequence	MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKG EMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFI IPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGV HPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYE VIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI SDLVKVTLTSEEEARLKKSADTLWGIQKELQF Click to Show/Hide
Uniprot ID	LDHA_HUMAN
Ensembl ID	ENSG00000134333
HGNC ID	HGNC:6535
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Fluorouracil

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Colon cancer				[1]
Sensitive Disease	Colon cancer [ICD-11: 2B90.1]			Disease Info
Sensitive Drug	Fluorouracil			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell apoptosis		Activation	hsa04210
	Cell proliferation		Inhibition	hsa05200
In Vitro Model	DLD1 cells	Colon	Homo sapiens (Human)	CVCL_0248
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	MTT assay
Mechanism Description	LDHA was shown to be a direct target of miR 34a. Overexpression of miR 34a reduced the expression of LDHA, probably through binding to the 3' untranslated region, leading to the re sensitization of 5 FU resistant cancer cells to 5 FU. Additionally, overexpression of LDHA rendered colon cancer cells resistant to 5 FU, suggesting that the miR 34a induced sensitization to 5 FU is mediated through the inhibition of LDHA. The current study showed that miR 34a is involved in sensitivity to 5 FU in part through its effects on LDHA expression.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Colon cancer [ICD-11: 2B90]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Colon
The Specified Disease	Colon cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.21E-52; Fold-change: 4.43E-01; Z-score: 1.90E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.78E-13; Fold-change: 2.91E-01; Z-score: 9.38E-01
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	Inhibition of lactate dehydrogenase A by microRNA-34a resensitizes colon cancer cells to 5-fluorouracil. Mol Med Rep. 2015 Jan;11(1):577-82. doi: 10.3892/mmr.2014.2726. Epub 2014 Oct 21.