Molecule Information
General Information of the Molecule (ID: Mol00468)
Name |
LIM and SH3 domain protein 1 (LASP1)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
LASP-1; Metastatic lymph node gene 50 protein; MLN 50; MLN50
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
LASP1
|
||||
Gene ID | |||||
Location |
chr17:38869859-38921770[+]
|
||||
Sequence |
MNPNCARCGKIVYPTEKVNCLDKFWHKACFHCETCKMTLNMKNYKGYEKKPYCNAHYPKQ
SFTMVADTPENLRLKQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRIKKTQDQISNI KYHEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVA QSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVNVQQIDDGWM YGTVERTGDTGMLPANYVEAI Click to Show/Hide
|
||||
Function |
Plays an important role in the regulation of dynamic actin-based, cytoskeletal activities. Agonist-dependent changes in LASP1 phosphorylation may also serve to regulate actin-associated ion transport activities, not only in the parietal cell but also in certain other F-actin-rich secretory epithelial cell types (By similarity).
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Paclitaxel
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Endometrial cancer | [1] | |||
Resistant Disease | Endometrial cancer [ICD-11: 2C76.1] | |||
Resistant Drug | Paclitaxel | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell proliferation | Inhibition | hsa05200 | |
In Vitro Model | 293T cells | Breast | Homo sapiens (Human) | CVCL_0063 |
Ishikawa cells | Endometrium | Homo sapiens (Human) | CVCL_2529 | |
HEC-1A cells | Uterus | Homo sapiens (Human) | CVCL_0293 | |
In Vivo Model | Nude mouse xenograft model | Mus musculus | ||
Experiment for Molecule Alteration |
Western blot analysis | |||
Experiment for Drug Resistance |
CCK8 assay; Transwell migration assay; Matrigel invasion assay; Flow cytometry assay; TUNEL assay; Wound healing assay; Colony formation assay | |||
Mechanism Description | LINC00672 can down-regulate LASP1 expression as a locus-restricted cofactor for p53-mediated gene suppression, thus impacting EC malig.ncies and chemosensitivity to paclitaxel. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.