Molecule Information

General Information of the Molecule (ID: Mol00437)

Name	Interleukin-24 (IL24) ,Homo sapiens
Synonyms	IL-24; Melanoma differentiation-associated gene 7 protein; MDA-7; Suppression of tumorigenicity 16 protein; MDA7; ST16 Click to Show/Hide
Molecule Type	Protein
Gene Name	IL24
Gene ID	11009
Location	chr1:206897443-206904139[+]
Sequence	MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQ VKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTV FKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQL DVEAALTKALGEVDILLTWMQKFYKL Click to Show/Hide
Function	Has antiproliferative properties on melanoma cells and may contribute to terminal cell differentiation. Click to Show/Hide
Uniprot ID	IL24_HUMAN
Ensembl ID	ENSG00000162892
HGNC ID	HGNC:11346
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Osteosarcoma				[1]
Resistant Disease	Osteosarcoma [ICD-11: 2B51.0]			Disease Info
Resistant Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	ZBTB7A/LINC00473/IL24 signaling pathway		Regulation	hsa04630
In Vitro Model	MG63 cells	Bone marrow	Homo sapiens (Human)	CVCL_0426
	U2OS cells	Bone	Homo sapiens (Human)	CVCL_0042
Experiment for Molecule Alteration	RT-PCR; Dual-Luciferase reporter assay
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	LINC00473 promoted the activity of IL24 promoter and elevated IL24 expression. LINC00473 interacts with the transcript factor C/EBPbeta, facilitating its binding to the promoter of IL24, leading to decrease chemoresistance. The ZBTB7A-LINC00473-IL24 signaling axis plays an important role in regulating osteosarcoma chemoresistance.

References

Ref 1	ZBTB7A Enhances Osteosarcoma Chemoresistance by Transcriptionally Repressing lncRNALINC00473-IL24 Activity. Neoplasia. 2017 Nov;19(11):908-918. doi: 10.1016/j.neo.2017.08.008. Epub 2017 Sep 21.