Molecule Information
General Information of the Molecule (ID: Mol00417)
Name |
Homeobox protein Hox-A3 (HOXA3)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Homeobox protein Hox-1E; HOX1E
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
HOXA3
|
||||
Gene ID | |||||
Location |
chr7:27106184-27152583[-]
|
||||
Sequence |
MQKATYYDSSAIYGGYPYQAANGFAYNANQQPYPASAALGADGEYHRPACSLQSPSSAGG
HPKAHELSEACLRTLSAPPSQPPSLGEPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPP PPSSASPPQNASNNPTPANAAKSPLLNSPTVAKQIFPWMKESRQNTKQKTSSSSSGESCA GDKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQ NRRMKYKKDQKGKGMLTSSGGQSPSRSPVPPGAGGYLNSMHSLVNSVPYEPQSPPPFSKP PQGTYGLPPASYPASLPSCAPPPPPQKRYTAAGAGAGGTPDYDPHAHGLQGNGSYGTPHI QGSPVFVGGSYVEPMSNSGPALFGLTHLPHAASGAMDYGGAGPLGSGHHHGPGPGEPHPT YTDLTGHHPSQGRIQEAPKLTHL Click to Show/Hide
|
||||
Function |
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Dexamethasone
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Acute lymphocytic leukemia | [1] | |||
Resistant Disease | Acute lymphocytic leukemia [ICD-11: 2B33.0] | |||
Resistant Drug | Dexamethasone | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
EGFR/RAS/RAF/MEK/ERK signaling pathway | Activation | hsa01521 | ||
In Vitro Model | Jurkat cells | Pleural effusion | Homo sapiens (Human) | CVCL_0065 |
CCRF-CEM cells | Pleural effusion | Homo sapiens (Human) | CVCL_0207 | |
Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
Mechanism Description | TCF7L2 activated HOXA-AS2 decreased the glucocorticoid sensitivity in acute lymphoblastic leukemia through regulating HOXA3/EGFR/Ras/Raf/MEk/ERk pathway. |
Prednisone
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Acute lymphocytic leukemia | [1] | |||
Resistant Disease | Acute lymphocytic leukemia [ICD-11: 2B33.0] | |||
Resistant Drug | Prednisone | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Inhibition | hsa04210 | |
Cell proliferation | Activation | hsa05200 | ||
EGFR/RAS/RAF/MEK/ERK signaling pathway | Activation | hsa01521 | ||
In Vitro Model | Jurkat cells | Pleural effusion | Homo sapiens (Human) | CVCL_0065 |
CCRF-CEM cells | Pleural effusion | Homo sapiens (Human) | CVCL_0207 | |
Experiment for Molecule Alteration |
Western blot analysis; RT-qPCR | |||
Experiment for Drug Resistance |
CCK8 assay; Flow cytometry assay | |||
Mechanism Description | TCF7L2 activated HOXA-AS2 decreased the glucocorticoid sensitivity in acute lymphoblastic leukemia through regulating HOXA3/EGFR/Ras/Raf/MEk/ERk pathway. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.