Molecule Information

General Information of the Molecule (ID: Mol00403)

Name	Proheparin-binding EGF-like growth factor (HBEGF) ,Homo sapiens
Synonyms	HB-EGF; HBEGF; Diphtheria toxin receptor; DT-R; DTR; DTS; HEGFL Click to Show/Hide
Molecule Type	Protein
Gene Name	HBEGF
Gene ID	1839
Location	chr5:140332843-140346603[-]
Sequence	MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRK VRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGE CKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVG LLMFRYHRRGGYDVENEEKVKLGMTNSH Click to Show/Hide
Function	Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor. Click to Show/Hide
Uniprot ID	HBEGF_HUMAN
Ensembl ID	ENSG00000113070
HGNC ID	HGNC:3059
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cetuximab

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Head and neck squamous cell carcinoma				[1]
Resistant Disease	Head and neck squamous cell carcinoma [ICD-11: 2D42.1]			Disease Info
Resistant Drug	Cetuximab			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell proliferation		Activation	hsa05200
In Vitro Model	SCC1 cells	Tongue	Homo sapiens (Human)	CVCL_A5SA
	1Cc8 cells	Epithelium	Homo sapiens (Human)	CVCL_L893
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Immunoblotting analysis
Experiment for Drug Resistance	MTS assay
Mechanism Description	HB-EGF can induce EMT, enhance metastasis, and modulate chemotherapy resistance. Increased expression of HB-EGF due to down-regulation of miR-212 is a possible mechanism of cetuximab resistance.

References

Ref 1	Regulation of heparin-binding EGF-like growth factor by miR-212 and acquired cetuximab-resistance in head and neck squamous cell carcinoma. PLoS One. 2010 Sep 13;5(9):e12702. doi: 10.1371/journal.pone.0012702.