Molecule Information

General Information of the Molecule (ID: Mol00388)

Name	Trans-acting T-cell-specific transcription factor GATA-3 (GATA3) ,Homo sapiens
Synonyms	GATA-binding factor 3 Click to Show/Hide
Molecule Type	Protein
Gene Name	GATA3
Gene ID	2625
Location	chr10:8045378-8075198[+]
Sequence	MEVTADQPRWVSHHHPAVLNGQHPDTHHPGLSHSYMDAAQYPLPEEVDVLFNIDGQGNHV PPYYGNSVRATVQRYPPTHHGSQVCRPPLLHGSLPWLDGGKALGSHHTASPWNLSPFSKT SIHHGSPGPLSVYPPASSSSLSGGHASPHLFTFPPTPPKDVSPDPSLSTPGSAGSARQDE KECLKYQVPLPDSMKLESSHSRGSMTALGGASSSTHHPITTYPPYVPEYSSGLFPPSSLL GGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPL IKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEG IQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPT PMHPPSSLSFGPHHPSSMVTAMG Click to Show/Hide
Function	Transcriptional activator which binds to the enhancer of the T-cell receptor alpha and delta genes. Binds to the consensus sequence 5'-AGATAG-3'. Required for the T-helper 2 (Th2) differentiation process following immune and inflammatory responses. Positively regulates ASB2 expression (By similarity). Click to Show/Hide
Uniprot ID	GATA3_HUMAN
Ensembl ID	ENSG00000107485
HGNC ID	HGNC:4172
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

RTDM: Regulation by the Disease Microenvironment

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Paclitaxel

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Regulation by the Disease Microenvironment (RTDM)			Click to Show/Hide
Disease Class: Gastric cancer				[1]
Sensitive Disease	Gastric cancer [ICD-11: 2B72.1]			Disease Info
Sensitive Drug	Paclitaxel			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell proliferation		Inhibition	hsa05200
In Vitro Model	MGC-803 cells	Gastric	Homo sapiens (Human)	CVCL_5334
Experiment for Molecule Alteration	qRT-PCR
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	Exosomal delivery of miR 155 5p may induce EMT and chemoresistant phenotypes from paclitaxel resistant gastric cancer cells to the sensitive cells, which may be mediated by GATA3 and TP53INP1 suppression.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Gastric cancer [ICD-11: 2B72]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Gastric tissue
The Specified Disease	Gastric cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.38E-01; Fold-change: 2.34E-01; Z-score: 1.14E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.63E-02; Fold-change: 2.49E-03; Z-score: 1.02E-02
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	Paclitaxel resistant gastric cancer MGC 803 cells promote epithelial to mesenchymal transition and chemoresistance in paclitaxel sensitive cells via exosomal delivery of miR 155 5p. Int J Oncol. 2019 Jan;54(1):326-338. doi: 10.3892/ijo.2018.4601. Epub 2018 Oct 22.