Molecule Information

General Information of the Molecule (ID: Mol00374)

Name	Mitochondrial fission 1 protein (FIS1) ,Homo sapiens
Synonyms	FIS1 homolog; hFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11; TTC11; CGI-135 Click to Show/Hide
Molecule Type	Protein
Gene Name	FIS1
Gene ID	51024
Location	chr7:101239458-101252316[-]
Sequence	MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEE LLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKK DGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS Click to Show/Hide
Function	Involved in the fragmentation of the mitochondrial network and its perinuclear clustering. Plays a minor role in the recruitment and association of the fission mediator dynamin-related protein 1 (DNM1L) to the mitochondrial surface and mitochondrial fission. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission. Click to Show/Hide
Uniprot ID	FIS1_HUMAN
Ensembl ID	ENSG00000214253
HGNC ID	HGNC:21689
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Tongue squamous cell carcinoma				[1]
Resistant Disease	Tongue squamous cell carcinoma [ICD-11: 2B62.1]			Disease Info
Resistant Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell apoptosis		Inhibition	hsa04210
	Mitochondrial apoptotic signaling pathway		Regulation	hsa04210
In Vitro Model	CAL27 cells	Oral	Homo sapiens (Human)	CVCL_1107
	SCC9 cells	Tongue	Homo sapiens (Human)	CVCL_1685
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	TUNEL assay; Flow cytometry assay
Mechanism Description	FIS1 is able to regulate mitochondrial fission and cisplatin sensitivity. miR-483-5p is responsible for the downregulation of FIS1 and can suppress mitochondrial fission and apoptosis by targeting FIS1. Mitochondrial fission affects cisplatin sensitivity via the miR-483-5p-FIS1 axis in cancer cells.

References

Ref 1	miR-483-5p determines mitochondrial fission and cisplatin sensitivity in tongue squamous cell carcinoma by targeting FIS1. Cancer Lett. 2015 Jul 1;362(2):183-91. doi: 10.1016/j.canlet.2015.03.045. Epub 2015 Apr 2.