Molecule Information

General Information of the Molecule (ID: Mol00363)

Name	Ezrin (EZR) ,Homo sapiens
Synonyms	Cytovillin; Villin-2; p81; VIL2 Click to Show/Hide
Molecule Type	Protein
Gene Name	EZR
Gene ID	7430
Location	chr6:158765741-158819368[-]
Sequence	MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL Click to Show/Hide
Function	Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis. Click to Show/Hide
Uniprot ID	EZRI_HUMAN
Ensembl ID	ENSG00000092820
HGNC ID	HGNC:12691
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

5 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Tongue cancer				[1]
Resistant Disease	Tongue cancer [ICD-11: 2B62.0]			Disease Info
Resistant Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell apoptosis		Inhibition	hsa04210
	Cell proliferation		Activation	hsa05200
	Cell viability		Activation	hsa05200
	Ezrin/FAKT/Src signaling pathway		Activation	hsa05205
In Vitro Model	CAL27 cells	Oral	Homo sapiens (Human)	CVCL_1107
	SCC9 cells	Tongue	Homo sapiens (Human)	CVCL_1685
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	MTS assay; EdU assay; Flow cytometric analysis
Mechanism Description	KCNQ1OT1 promotes TSCC cell proliferation and chemo-resistance via the regulation of miR-211-5p mediated Ezrin/Fak/Src signaling.

Cyclophosphamide

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Diffuse large B-cell lymphoma				[2]
Resistant Disease	Diffuse large B-cell lymphoma [ICD-11: 2A81.0]			Disease Info
Resistant Drug	Cyclophosphamide			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell viability		Activation	hsa05200
	HDAC6/miR148b/Ezrin signaling pathway		Regulation	hsa05206
In Vitro Model	CRL2631 cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
	CRL2631/CHOP cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL.

Doxorubicin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Diffuse large B-cell lymphoma				[2]
Resistant Disease	Diffuse large B-cell lymphoma [ICD-11: 2A81.0]			Disease Info
Resistant Drug	Doxorubicin			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell viability		Activation	hsa05200
	HDAC6/miR148b/Ezrin signaling pathway		Regulation	hsa05206
In Vitro Model	CRL2631 cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
	CRL2631/CHOP cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL.

Prednisone

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Diffuse large B-cell lymphoma				[2]
Resistant Disease	Diffuse large B-cell lymphoma [ICD-11: 2A81.0]			Disease Info
Resistant Drug	Prednisone			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell viability		Activation	hsa05200
	HDAC6/miR148b/Ezrin signaling pathway		Regulation	hsa05206
In Vitro Model	CRL2631 cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
	CRL2631/CHOP cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL.

Vincristine

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Diffuse large B-cell lymphoma				[2]
Resistant Disease	Diffuse large B-cell lymphoma [ICD-11: 2A81.0]			Disease Info
Resistant Drug	Vincristine			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell viability		Activation	hsa05200
	HDAC6/miR148b/Ezrin signaling pathway		Regulation	hsa05206
In Vitro Model	CRL2631 cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
	CRL2631/CHOP cells	Bone marrow	Homo sapiens (Human)	CVCL_3611
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	CCK8 assay
Mechanism Description	The high level of HDAC6 inhibited miR-148b via maintaining the low acetylation of histones H3 and H4 in the miR-148b promoter, thus rescuing Ezrin expression and promoting CHOP resistance in DLBCL.

References

Ref 1	LncRNA KCNQ1OT1 regulates proliferation and cisplatin resistance in tongue cancer via miR-211-5p mediated Ezrin/Fak/Src signaling. Cell Death Dis. 2018 Jul 3;9(7):742. doi: 10.1038/s41419-018-0793-5.
Ref 2	Down-regulated miR-148b increases resistance to CHOP in diffuse large B-cell lymphoma cells by rescuing Ezrin. Biomed Pharmacother. 2018 Oct;106:267-274. doi: 10.1016/j.biopha.2018.06.093. Epub 2018 Jun 28.