Molecule Information

General Information of the Molecule (ID: Mol00302)

Name	Cytoplasmic polyadenylation element-binding protein 2 (CPEB2) ,Homo sapiens
Synonyms	CPE-BP2; CPE-binding protein 2; hCPEB-2 Click to Show/Hide
Molecule Type	Protein
Gene Name	CPEB2
Gene ID	132864
Location	chr4:15002481-15070153[+]
Sequence	MPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCTGLSVPTSGGGGGGFGGPFSATAV PPPPPPAMNIPQQQPPPPAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQPLL KQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKF TRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRID QDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDGL LDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVV DWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKY PKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFA PFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN Click to Show/Hide
Function	May play a role in translational regulation of stored mRNAs in transcriptionally inactive haploid spermatids. Binds to poly(U) RNA oligomers. Required for cell cycle progression, specifically for the transition from metaphase to anaphase. Click to Show/Hide
Uniprot ID	CPEB2_HUMAN
Ensembl ID	ENSG00000137449
HGNC ID	HGNC:21745
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Methotrexate

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Colorectal cancer				[1]
Resistant Disease	Colorectal cancer [ICD-11: 2B91.1]			Disease Info
Resistant Drug	Methotrexate			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	HCT-8 cells	Colon	Homo sapiens (Human)	CVCL_2478
	HT-29-R cells	Colon	Homo sapiens (Human)	CVCL_6834
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	MTT assay; Flow cytometric analysis
Mechanism Description	CPEB2 is the functional target of miR186 to modulate colorectal cancer cells sensitive to MTX.

Paclitaxel

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Nasopharyngeal carcinoma				[2]
Resistant Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B.0]			Disease Info
Resistant Drug	Paclitaxel			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	CNE2 cells	Nasopharynx	Homo sapiens (Human)	CVCL_6889
	CNE1 cells	Throat	Homo sapiens (Human)	CVCL_6888
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	MTT assay
Mechanism Description	CCAT1 reduced the sensitivity of NPC cells to paclitaxel by suppressing miR181a level and subsequently regulating CPEB2 to monitor NPC cell growth.

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Nasopharyngeal carcinoma				[2]
Sensitive Disease	Nasopharyngeal carcinoma [ICD-11: 2B6B.0]			Disease Info
Sensitive Drug	Paclitaxel			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	CCAT1/miR181a/CPEB2 signaling pathway		Regulation	hsa05206
In Vitro Model	CNE2 cells	Nasopharynx	Homo sapiens (Human)	CVCL_6889
	CNE1 cells	Throat	Homo sapiens (Human)	CVCL_6888
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	MTT assay
Mechanism Description	LncRNA CCAT1 regulates the sensitivity of paclitaxel in NPC cells via miR181a/CPEB2 axis. miR181a restores CCAT1-induced paclitaxel resistant in NPC cells via targeting CPEB2.

References

Ref 1	TUG1 mediates methotrexate resistance in colorectal cancer via miR-186/CPEB2 axis. Biochem Biophys Res Commun. 2017 Sep 16;491(2):552-557. doi: 10.1016/j.bbrc.2017.03.042. Epub 2017 Mar 14.
Ref 2	LncRNA CCAT1 modulates the sensitivity of paclitaxel in nasopharynx cancers cells via miR-181a/CPEB2 axis. Cell Cycle. 2017 Apr 18;16(8):795-801. doi: 10.1080/15384101.2017.1301334. Epub 2017 Mar 30.