Molecule Information
General Information of the Molecule (ID: Mol00276)
Name |
Cyclin-A2 (CCNA2)
,Homo sapiens
|
||||
---|---|---|---|---|---|
Synonyms |
Cyclin-A; Cyclin A; CCN1; CCNA
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
CCNA2
|
||||
Gene ID | |||||
Location |
chr4:121816444-121823883[-]
|
||||
Sequence |
MLGNSAPGPATREAGSALLALQQTALQEDQENINPEKAAPVQQPRTRAALAVLKSGNPRG
LAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKI EREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHE DIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYID RFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLK VLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAF HLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHG VSLLNPPETLNL Click to Show/Hide
|
||||
Function |
Cyclin which controls both the G1/S and the G2/M transition phases of the cell cycle. Functions through the formation of specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers the substrate specificity of these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Ensembl ID | |||||
HGNC ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Metformin
Drug Sensitivity Data Categorized by Their Corresponding Mechanisms | ||||
Unusual Activation of Pro-survival Pathway (UAPP) | ||||
Disease Class: Acute lymphocytic leukemia | [1] | |||
Sensitive Disease | Acute lymphocytic leukemia [ICD-11: 2B33.0] | |||
Sensitive Drug | Metformin | |||
Molecule Alteration | Expression | Down-regulation |
||
Experimental Note | Revealed Based on the Cell Line Data | |||
Cell Pathway Regulation | Cell apoptosis | Activation | hsa04210 | |
Cell proliferation | Inhibition | hsa05200 | ||
LKB1/AMPk signaling pathway | Activation | hsa04152 | ||
mTOR signaling pathway | Inhibition | hsa04150 | ||
In Vitro Model | ALL CEM cells | Lymph | Homo sapiens (Human) | CVCL_0207 |
Experiment for Molecule Alteration |
Western blotting analysis | |||
Experiment for Drug Resistance |
XTT assay | |||
Mechanism Description | In metformin-sensitive cells, autophagy was not induced but rather it blocked proliferation by means of arresting cells in the S and G2/M phases which was associated with the downregulation of cyclin A, cyclin B1, and cdc2, but not that of cyclin E. In 10E1-CEM cells that overexpress Bcl-2 and are drug-resistant, the effect of metformin on proliferation was more pronounced, also inducing the activation of the caspases 3/7 and hence apoptosis. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.