Molecule Information

General Information of the Molecule (ID: Mol00256)

• Name: Bcl-2-modifying factor (BMF) ,Homo sapiens
• Molecule Type: Protein
• Gene Name: BMF
• Gene ID: 90427
• Location: chr15:40087890-40108892[-]
• Sequence:
  MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
  RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQP
  PEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNG
  AGPR
• Function: May play a role in apoptosis. Isoform 1 seems to be the main initiator.
• Uniprot ID: BMF_HUMAN
• Ensembl ID: ENSG00000104081
• HGNC ID: HGNC:24132

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Paclitaxel

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Epigenetic Alteration of DNA, RNA or Protein (EADR)

Disease Class: Lung cancer [1]

• Resistant Disease: Lung cancer [ICD-11: 2C25.5]
• Resistant Drug: Paclitaxel
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• Cell Pathway Regulation: Cell apoptosis; Inhibition; hsa04210
• In Vitro Model: A549 cells; Lung; Homo sapiens (Human); CVCL_0023
• In Vitro Model: H460 cells; Lung; Homo sapiens (Human); CVCL_0459
• Experiment for Molecule Alteration: Luciferase assay
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: Bmf (Bcl-2-modifying factor) is a target of miR-34c-5p, and that its silencing, together with that of c-myc, a known target of miR-34c-5p, contributes to resistance to apoptosis induced by paclitaxel through p53 downregulation.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Lung cancer [ICD-11: 2C25]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Lung
• The Specified Disease: Lung cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 7.56E-26; Fold-change: 3.76E-01; Z-score: 1.09E+00
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 2.39E-07; Fold-change: 2.66E-01; Z-score: 6.10E-01

References

• Ref 1: miR-34c may protect lung cancer cells from paclitaxel-induced apoptosis. Oncogene. 2013 Jan 17;32(3):341-51. doi: 10.1038/onc.2012.51. Epub 2012 Feb 27.