Molecule Information

General Information of the Molecule (ID: Mol00236)

Name	Arylamine N-acetyltransferase 1 (NAT1) ,Homo sapiens
Synonyms	Arylamide acetylase 1; Monomorphic arylamine N-acetyltransferase; MNAT; N-acetyltransferase type 1; NAT-1; AAC1 Click to Show/Hide
Molecule Type	Protein
Gene Name	NAT1
Gene ID	9
Location	chr8:18170477-18223689[+]
Sequence	MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVV RRNRGGWCLQVNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYI VDAGFGRSYQMWQPLELISGKDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDL LEDSKYRKIYSFTLKPRTIEDFESMNTYLQTSPSSVFTSKSFCSLQTPDGVHCLVGFTLT HRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLVPKHGDRFFTI Click to Show/Hide
Function	Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens. Click to Show/Hide
Uniprot ID	ARY1_HUMAN
Ensembl ID	ENSG00000171428
HGNC ID	HGNC:7645
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

EADR: Epigenetic Alteration of DNA, RNA or Protein

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Tamoxifen

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Epigenetic Alteration of DNA, RNA or Protein (EADR)		Click to Show/Hide
Disease Class: Breast cancer			[1]
Resistant Disease	Breast cancer [ICD-11: 2C60.3]		Disease Info
Resistant Drug	Tamoxifen		Drug Info
Molecule Alteration	Epigenetic modification	Methylation aberrance
Experimental Note	Identified from the Human Clinical Data
Experiment for Molecule Alteration	Bisulfite genomic sequencing assay; Methylation-specific PCR assay
Mechanism Description	Taken together, the higher methylation rate of the NAT1 gene is related to tamoxifen resistance, and this fact supports the hypothesis that hypermethylation of the NAT1 gene might affect the initiation of tamoxifen resistance.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Breast cancer [ICD-11: 2C60]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 1.77E-56; Fold-change: 1.54E+00; Z-score: 1.36E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 1.12E-11; Fold-change: 1.61E+00; Z-score: 1.26E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	Methylation patterns of genes coding for drug-metabolizing enzymes in tamoxifen-resistant breast cancer tissues. J Mol Med (Berl). 2010 Nov;88(11):1123-31. doi: 10.1007/s00109-010-0652-z. Epub 2010 Jul 14.