Molecule Information

General Information of the Molecule (ID: Mol00209)

• Name: Solute carrier family 21 member 6 (SLC21A6) ,Homo sapiens
• Synonyms: Liver-specific organic anion transporter 1; LST-1; OATP-C; Sodium-independent organic anion-transporting polypeptide 2; OATP-2; Solute carrier family 21 member 6; LST1; OATP1B1; OATP2; OATPC; SLC21A6
• Molecule Type: Protein
• Gene Name: SLCO1B1
• Gene ID: 10599
• Location: chr12:21131194-21239796[+]
• Sequence:
  MDQNQHLNKTAEAQPSENKKTRYCNGLKMFLAALSLSFIAKTLGAIIMKSSIIHIERRFE
  ISSSLVGFIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCFIMGIGGVLTALPHFFMGY
  YRYSKETNINSSENSTSTLSTCLINQILSLNRASPEIVGKGCLKESGSYMWIYVFMGNML
  RGIGETPIVPLGLSYIDDFAKEGHSSLYLGILNAIAMIGPIIGFTLGSLFSKMYVDIGYV
  DLSTIRITPTDSRWVGAWWLNFLVSGLFSIISSIPFFFLPQTPNKPQKERKASLSLHVLE
  TNDEKDQTANLTNQGKNITKNVTGFFQSFKSILTNPLYVMFVLLTLLQVSSYIGAFTYVF
  KYVEQQYGQPSSKANILLGVITIPIFASGMFLGGYIIKKFKLNTVGIAKFSCFTAVMSLS
  FYLLYFFILCENKSVAGLTMTYDGNNPVTSHRDVPLSYCNSDCNCDESQWEPVCGNNGIT
  YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAI
  QVLNLFFSALGGTSHVMLIVKIVQPELKSLALGFHSMVIRALGGILAPIYFGALIDTTCI
  KWSTNNCGTRGSCRTYNSTSFSRVYLGLSSMLRVSSLVLYIILIYAMKKKYQEKDINASE
  NGSVMDEANLESLNKNKHFVPSAGADSETHC
• Function: Mediates the Na(+)-independent uptake of organic anions such as pravastatin, taurocholate, methotrexate, dehydroepiandrosterone sulfate, 17-beta-glucuronosyl estradiol, estrone sulfate, prostaglandin E2, thromboxane B2, leukotriene C3, leukotriene E4, thyroxine and triiodothyronine. Involved in the clearance of bile acids and organic anions from the liver.
• Uniprot ID: SO1B1_HUMAN
• Ensembl ID: ENSG00000134538
• HGNC ID: HGNC:10959

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Rosuvastatin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Hyperlipidemia [1]

• Sensitive Disease: Hyperlipidemia [ICD-11: 5C80.Z]
• Sensitive Drug: Rosuvastatin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• Mechanism Description: Enasidenib (and its metabolite, AGI-16903) at clinically relevant concentrations has effects on multiple drug metabolic enzymes and transporters, including inhibition of P-gp, BCRP, OATP1B1, and OATP1B3 transporters. When a single dose of rosuvastatin was administered together with 28 days of dosing of enasidenib, the AUC0-30 and AUC0-inf of rosuvastatin increased by =249% and 244%, respectively; and the Cmax increased by 366%, when compared to the single dose of rosuvastatin administered alone.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 05

Hyperlipoproteinaemia [ICD-11: 5C80]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Whole blood
• The Specified Disease: Familial hypercholesterolemia
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 3.27E-01; Fold-change: -5.78E-02; Z-score: -3.84E-01

References

• Ref 1: Assessment of Transporter-Mediated Drug Interactions for Enasidenib Based on a Cocktail Study in Patients With Relapse or Refractory Acute Myeloid Leukemia or Myelodysplastic Syndrome. J Clin Pharmacol. 2022 Apr;62(4):494-504. doi: 10.1002/jcph.1979. Epub 2021 Oct 27.