Molecule Information

General Information of the Molecule (ID: Mol00203)

• Name: Mth938 domain-containing protein (AAMDC) ,Homo sapiens
• Synonyms: Adipogenesis associated Mth938 domain-containing protein; C11orf67; PTD015
• Molecule Type: Protein
• Gene Name: AAMDC
• Gene ID: 28971
• Location: chr11:77821109-77918432[+]
• Sequence:
  MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK
  GVQTLVIGRGMSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHS
  TC
• Function: May play a role in preadipocyte differentiation and adipogenesis.
• Uniprot ID: AAMDC_HUMAN
• Ensembl ID: ENSG00000087884
• HGNC ID: HGNC:30205

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Everolimus

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Breast cancer [1]

• Resistant Disease: Breast cancer [ICD-11: 2C60.3]
• Resistant Drug: Everolimus
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Cell apoptosis; Inhibition; hsa04210
• Cell Pathway Regulation: Cell migration; Activation; hsa04670
• Cell Pathway Regulation: Cell proliferation; Activation; hsa05200
• Cell Pathway Regulation: PI3K/AKT/mTOR signaling pathway; Activation; hsa04151
• In Vitro Model: MCF-7 cells; Breast; Homo sapiens (Human); CVCL_0031
• In Vitro Model: SkBR3 cells; Breast; Homo sapiens (Human); CVCL_0033
• In Vitro Model: MDA-MB-231 cells; Breast; Homo sapiens (Human); CVCL_0062
• In Vitro Model: HEK293T cells; Kidney; Homo sapiens (Human); CVCL_0063
• In Vitro Model: T47D cells; Breast; Homo sapiens (Human); CVCL_0553
• In Vitro Model: ZR75-1 cells; Breast; Homo sapiens (Human); CVCL_0588
• In Vitro Model: BT549 cells; Breast; Homo sapiens (Human); CVCL_1092
• In Vitro Model: MCF-12A cells; Breast; Homo sapiens (Human); CVCL_3744
• In Vitro Model: SUM159 cells; Breast; Homo sapiens (Human); CVCL_5423
• In Vitro Model: SUM44PE cells; Breast; Homo sapiens (Human); CVCL_3424
• In Vitro Model: SUM52PE cells; Breast; Homo sapiens (Human); CVCL_3425
• In Vivo Model: BALB/cJ Foxn1/Arc nude mice xenografts model; Mus musculus
• Experiment for Molecule Alteration: Western blotting analysis
• Experiment for Drug Resistance: CellTiter-Glo 2.0 luminescence assay protocol assay
• Mechanism Description: High AAMDC expression is associated with sensitization to dactolisib and everolimus, and these PI3k-mTOR inhibitors exhibit synergistic interactions with anti-estrogens in IntClust2 models. Ectopic AAMDC expression is sufficient to activate AkT signaling, resulting in estrogen-independent tumor growth. Thus, AAMDC-overexpressing tumors may be sensitive to PI3k-mTORC1 blockers in combination with anti-estrogens.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Breast cancer [ICD-11: 2C60]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Breast tissue
• The Specified Disease: Breast cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 4.20E-04; Fold-change: -1.60E-01; Z-score: -2.73E-01
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 4.77E-03; Fold-change: -2.50E-01; Z-score: -6.95E-01

References

• Ref 1: The oncogene AAMDC links PI3K-AKT-mTOR signaling with metabolic reprograming in estrogen receptor-positive breast cancer. Nat Commun. 2021 Mar 26;12(1):1920. doi: 10.1038/s41467-021-22101-7.