Molecule Information

General Information of the Molecule (ID: Mol00185)

Name	Tumor protein D52 (TPD52) ,Homo sapiens
Synonyms	Protein N8 Click to Show/Hide
Molecule Type	Protein
Gene Name	TPD52
Gene ID	7163
Location	chr8:80034745-80231232[-]
Sequence	MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKFGLLRTDPVPEEGED VAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELK QNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEK VENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL Click to Show/Hide
Uniprot ID	TPD52_HUMAN
Ensembl ID	ENSG00000076554
HGNC ID	HGNC:12005
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Paclitaxel

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Breast cancer				[1]
Resistant Disease	Breast cancer [ICD-11: 2C60.3]			Disease Info
Resistant Drug	Paclitaxel			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell apoptosis		Inhibition	hsa04210
	Wnt/Beta-catenin signaling pathway		Activation	hsa04310
In Vitro Model	MCF-7 cells	Breast	Homo sapiens (Human)	CVCL_0031
Experiment for Molecule Alteration	Western blot analysis; RT-qPCR
Experiment for Drug Resistance	MTT assay
Mechanism Description	miR-107 could enhance PTX sensitivity in breast cancer cells may be targeting TPD52 through Wnt/beta-catenin signaling pathway. And downregualtion of miR-107 ould enhance PTX resistance in BC cells.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Breast cancer [ICD-11: 2C60]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Breast tissue
The Specified Disease	Breast cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 8.37E-86; Fold-change: 1.65E+00; Z-score: 1.58E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 4.90E-12; Fold-change: 1.37E+00; Z-score: 1.23E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	miR-107 Enhances the Sensitivity of Breast Cancer Cells to Paclitaxel. Open Med (Wars). 2019 Jun 1;14:456-466. doi: 10.1515/med-2019-0049. eCollection 2019.