Molecule Information

General Information of the Molecule (ID: Mol00177)

Name	Testis development-related protein 1 (TDRG1) ,Homo sapiens
Molecule Type	Protein
Gene Name	TDRG1
Sequence	MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGS RLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL Click to Show/Hide
Uniprot ID	TDRG1_HUMAN
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Seminoma				[1]
Resistant Disease	Seminoma [ICD-11: 2C80.3]			Disease Info
Resistant Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Revealed Based on the Cell Line Data
Cell Pathway Regulation	Cell apoptosis		Inhibition	hsa04210
	Cell proliferation		Activation	hsa05200
	PI3K/AKT/mTOR signaling pathway		Regulation	hsa04151
In Vitro Model	TCam-2 cells	Testicle	Homo sapiens (Human)	CVCL_T012
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis; RT-qPCR
Experiment for Drug Resistance	MTT assay; Flow cytometry assay
Mechanism Description	Long non-coding RNA H19 promotes TDRG1 expression and cisplatin resistance by sequestering miRNA-106b-5p in seminoma.

References

Ref 1	Long non-coding RNA H19 promotes TDRG1 expression and cisplatin resistance by sequestering miRNA-106b-5p in seminoma. Cancer Med. 2018 Dec;7(12):6247-6257. doi: 10.1002/cam4.1871. Epub 2018 Nov 14.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.