Molecule Information

General Information of the Molecule (ID: Mol00174)

• Name: Stathmin (STMN1) ,Homo sapiens
• Synonyms: Leukemia-associated phosphoprotein p18; Metablastin; Oncoprotein 18; Op18; Phosphoprotein p19; pp19; Prosolin; Protein Pr22; pp17; C1orf215; LAP18; OP18
• Molecule Type: Protein
• Gene Name: STMN1
• Gene ID: 3925
• Location: chr1:25884181-25906991[-]
• Sequence:
  MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEER
  RKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKL
  ERLREKDKHIEEVRKNKESKDPADETEAD
• Function: Involved in the regulation of the microtubule (MT) filament system by destabilizing microtubules. Prevents assembly and promotes disassembly of microtubules. Phosphorylation at Ser-16 may be required for axon formation during neurogenesis. Involved in the control of the learned and innate fear (By similarity).
• Uniprot ID: STMN1_HUMAN
• Ensembl ID: ENSG00000117632
• HGNC ID: HGNC:6510

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Docetaxel

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gallbladder cancer [1]

• Sensitive Disease: Gallbladder cancer [ICD-11: 2C13.0]
• Sensitive Drug: Docetaxel
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Revealed Based on the Cell Line Data
• In Vitro Model: GBC-SD cells; Gallbladder; Homo sapiens (Human); CVCL_6903
• In Vitro Model: NOZ cells; Gallbladder; Homo sapiens (Human); CVCL_3079
• In Vivo Model: Nude mouse xenograft model; Mus musculus
• Experiment for Molecule Alteration: Western blot analysis
• Experiment for Drug Resistance: CCK8 assay
• Mechanism Description: miR223 increases gallbladder cancer cell sensitivity to docetaxel by downregulating STMN1.

Doxorubicin

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Breast cancer [2]

• Sensitive Disease: Breast cancer [ICD-11: 2C60.3]
• Sensitive Drug: Doxorubicin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: MDA-MB-231 cells; Breast; Homo sapiens (Human); CVCL_0062
• In Vitro Model: MDA-MB-468 cells; Breast; Homo sapiens (Human); CVCL_0419
• Experiment for Molecule Alteration: qRT-PCR; Western blot analysis; Dua-luciferase reporter assay
• Experiment for Drug Resistance: MTT assay
• Mechanism Description: miR770, a potential tumor suppressor, could specifically target and down-regulate STMN1, thus inhibit the metastasis and chemo-resistance of TNBC cells.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Breast cancer [ICD-11: 2C60]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Breast tissue
• The Specified Disease: Breast cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 7.39E-59; Fold-change: 4.31E-01; Z-score: 1.32E+00
• The Expression Level of Disease Section Compare with the Adjacent Tissue: p-value: 3.11E-06; Fold-change: 2.13E-01; Z-score: 6.15E-01

References

• Ref 1: miR-223 increases gallbladder cancer cell sensitivity to docetaxel by downregulating STMN1. Oncotarget. 2016 Sep 20;7(38):62364-62376. doi: 10.18632/oncotarget.11634.
• Ref 2: MiR-770 suppresses the chemo-resistance and metastasis of triple negative breast cancer via direct targeting of STMN1. Cell Death Dis. 2018 Jan 11;9(1):14. doi: 10.1038/s41419-017-0030-7.