Molecule Information

General Information of the Molecule (ID: Mol00141)

Name	Zinc finger protein PLAGL2 (PLAGL2) ,Homo sapiens
Synonyms	Pleiomorphic adenoma-like protein 2; KIAA0198 Click to Show/Hide
Molecule Type	Protein
Gene Name	PLAGL2
Gene ID	5326
Location	chr20:32192504-32207743[-]
Sequence	MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEISGTPFSNGEKLRPHSL PQPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKMFHRKDHLRNHLQTH DPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQALLEHLKAHSR RVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTRHVKK SHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASRDVMGTKAFPGMLPMGMYGA HIPTMPSTGVPHSLVHNTLPMGMSYPLESSPISSPAQLPPKYQLGSTSYLPDKLPKVEVD SFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKSPANLSEALCAANVDFSHLLGF LPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQDSPGAGGPLNFGPLHSLPPVFT SGLSSTTLPRFHQAFQ Click to Show/Hide
Function	Shows weak transcriptional activatory activity. Click to Show/Hide
Uniprot ID	PLAL2_HUMAN
Ensembl ID	ENSG00000126003
HGNC ID	HGNC:9047
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Paclitaxel

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Ovarian cancer				[1]
Resistant Disease	Ovarian cancer [ICD-11: 2C73.0]			Disease Info
Resistant Drug	Paclitaxel			Drug Info
Molecule Alteration	Expression		Up-regulation
Experimental Note	Identified from the Human Clinical Data
Cell Pathway Regulation	Cell apoptosis		Inhibition	hsa04210
	Cell proliferation		Activation	hsa05200
	MYC/WNT/AKT signaling pathway		Regulation	hsa04217
In Vitro Model	SkOV3 cells	Ovary	Homo sapiens (Human)	CVCL_0532
	A2780 cells	Ovary	Homo sapiens (Human)	CVCL_0134
In Vivo Model	NMRI-nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	Western blot analysis
Experiment for Drug Resistance	Time course proliferation assay; Flow cytometry assay
Mechanism Description	CDCP1 and PLAGL2 oncogenes were found to be the most relevant direct miR-654-5p targets and both genes convey in a molecular signature associated with key cancer pathways relevant to ovarian tumorigenesis, such as MYC, WNT and AkT pathways.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Click to Show/Hide the Resistance Disease of This Class

Ovarian cancer [ICD-11: 2C73]

Click to Show/Hide

Differential expression of molecule in resistant diseases
The Studied Tissue	Ovary
The Specified Disease	Ovarian cancer
The Expression Level of Disease Section Compare with the Healthy Individual Tissue	p-value: 4.68E-03; Fold-change: 6.89E-01; Z-score: 1.35E+00
The Expression Level of Disease Section Compare with the Adjacent Tissue	p-value: 5.53E-09; Fold-change: 7.45E-01; Z-score: 3.01E+00
Molecule expression in the normal tissue adjacent to the diseased tissue of patients Molecule expression in the diseased tissue of patients Molecule expression in the normal tissue of healthy individuals
Disease-specific Molecule Abundances		Click to View the Clearer Original Diagram
Download Molecule expression barchart for all samples Download Molecule expression data of patients in the normal section of the tissue adjacent to the disease section Download Molecule expression data of patients in the disease section of the tissue Download Molecule expression data in the tissue of healthy individual

Tissue-specific Molecule Abundances in Healthy Individuals

Click to Show/Hide the Molecule Abundances


Download the Tissue-Specific Variation(s) Profile

References

Ref 1	MicroRNA-654-5p suppresses ovarian cancer development impacting on MYC, WNT and AKT pathways. Oncogene. 2019 Aug;38(32):6035-6050. doi: 10.1038/s41388-019-0860-0. Epub 2019 Jul 5.