Molecule Information

General Information of the Molecule (ID: Mol00084)

• Name: High mobility group protein HMG-I/HMG-Y (HMGA1) ,Homo sapiens
• Synonyms: HMG-I(Y); High mobility group AT-hook protein 1; High mobility group protein A1; High mobility group protein R; HMGIY
• Molecule Type: Protein
• Gene Name: HMGA1
• Gene ID: 3159
• Location: chr6:34236873-34246231[+]
• Sequence:
  MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGR
  PKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
• Function: HMG-I/Y bind preferentially to the minor groove of A+T rich regions in double-stranded DNA. It is suggested that these proteins could function in nucleosome phasing and in the 3'-end processing of mRNA transcripts. They are also involved in the transcription regulation of genes containing, or in close proximity to A+T-rich regions.
• Uniprot ID: HMGA1_HUMAN
• Ensembl ID: ENSG00000137309
• HGNC ID: HGNC:5010

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cisplatin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Bladder cancer [1]

• Resistant Disease: Bladder cancer [ICD-11: 2C94.0]
• Resistant Drug: Cisplatin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• Cell Pathway Regulation: Cell apoptosis; Inhibition; hsa04210
• In Vitro Model: 5637 cells; Bladder; Homo sapiens (Human); CVCL_0126
• In Vitro Model: T24 cells; Bladder; Homo sapiens (Human); CVCL_0554
• In Vitro Model: SW780 cells; Bladder; Homo sapiens (Human); CVCL_1728
• Experiment for Molecule Alteration: Western blot analysis; qRT-PCR
• Experiment for Drug Resistance: MTT assay; Flow cytometry assay
• Mechanism Description: HMGA1 contributes to Cis resistance in bladder cancer by hampering the transcription activity of p53 family proteins.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 02

Bladder cancer [ICD-11: 2C94]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Bladder tissue
• The Specified Disease: Bladder cancer
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 4.61E-03; Fold-change: 1.05E+00; Z-score: 2.08E+00

References

• Ref 1: The long noncoding RNA HIF1A-AS2 facilitates cisplatin resistance in bladder cancer. J Cell Biochem. 2019 Jan;120(1):243-252. doi: 10.1002/jcb.27327. Epub 2018 Sep 14.