Molecule Information

General Information of the Molecule (ID: Mol00052)

Name	Alpha-crystallin B chain (CRYAB) ,Homo sapiens
Synonyms	Alpha(B)-crystallin; Heat shock protein beta-5; HspB5; Renal carcinoma antigen NY-REN-27; Rosenthal fiber component; CRYA2; HSPB5 Click to Show/Hide
Molecule Type	Protein
Gene Name	CRYAB
Gene ID	1410
Location	chr11:111908564-111923722[-]
Sequence	MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSW FDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHR KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK Click to Show/Hide
Function	May contribute to the transparency and refractive index of the lens. Has chaperone-like activity, preventing aggregation of various proteins under a wide range of stress conditions. In lens epithelial cells, stabilizes the ATP6V1A protein, preventing its degradation by the proteasome (By similarity). Click to Show/Hide
Uniprot ID	CRYAB_HUMAN
Ensembl ID	ENSG00000109846
HGNC ID	HGNC:2389
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Cisplatin

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)			Click to Show/Hide
Disease Class: Osteosarcoma				[1]
Sensitive Disease	Osteosarcoma [ICD-11: 2B51.0]			Disease Info
Sensitive Drug	Cisplatin			Drug Info
Molecule Alteration	Expression		Down-regulation
Experimental Note	Revealed Based on the Cell Line Data
In Vitro Model	MG63 cells	Bone marrow	Homo sapiens (Human)	CVCL_0426
	SAOS-2 cells	Bone marrow	Homo sapiens (Human)	CVCL_0548
	U2OS cells	Bone	Homo sapiens (Human)	CVCL_0042
In Vivo Model	Nude mouse xenograft model			Mus musculus
Experiment for Molecule Alteration	qRT-PCR; Luciferase reporter assay; Western blot analysis; Western blot analysis; Immunohistochemistry assay
Experiment for Drug Resistance	MTT assay
Mechanism Description	Overexpression of miR491 inhibits chemoresistance and suppresses OS cell lung metastasis, whereas it enhances cisplatin (CDDP)-induced tumor growth inhibition and apoptosis, miR491 exerts its role by directly targeting alphaB-crystallin (CRYAB) in OS.

References

Ref 1	miR-491 Inhibits Osteosarcoma Lung Metastasis and Chemoresistance by Targeting AlphaB-crystallin. Mol Ther. 2017 Sep 6;25(9):2140-2149. doi: 10.1016/j.ymthe.2017.05.018. Epub 2017 Jun 23.